-
Normal mucus transport is restored in ciliated airway cultures derived from p...
Normal mucus transport is restored in ciliated airway cultures derived from patients with cystic fibrosis after replacement of the CFTR gene. This image represents yellow... -
Characteristics of patients included in the study.
CRC, colorectal cancer; NA, not applied. 1Qualitative variables were compared by the Fisher's exact test; continuous variables were compared by the Mann-Whitney U's... -
Additional file 1: of Prevalence, heritability and genetic correlations of co...
Phenotypic data of 1060 English bull terrier puppies included in the study. Phenotypic data file, including animal identification numbers, effects and phenotypic data; fields... -
Room-Temperature Desulfurization of Dibenzothiophene Mediated by [(<i>i</i>-P...
Room-Temperature Desulfurization of Dibenzothiophene Mediated by [(i-Pr2PCH2)2NiH]2 -
Characteristics of study subjects.
JA-1, first-generation Japanese-Americans; JA-2, second- or later-generation Japanese-Americans; BMI, body mass index; BP, blood pressure; 2-h, two-hour post-load; HOMA-IR,... -
Primers used in this study.
a Liu et al., 2011 [19]. b Ji et al., 2007 [20]. c Wei et al., 2010 [21]. d Noteborn et al., 2013 [22]. *Positions correspond to: IBDV (JQ684022), IBV (KJ425500), AEV... -
MOESM1 of Expression profiling of the ubiquitin conjugating enzyme UbcM2 in m...
Additional file 1: Figure S1. UbcM2 is ubiquitously expressed in neurons of mouse brain. Representative photomicrographs from a 7 µm paraffin-embedded sagittal brain section... -
Characteristics of the study population.
SD = standard deviation; BMI = body mass index; BFP = Body fat percentage measured with bioelectrical impedance [24]; WHR = waist-hip ratio; HGS = handgrip strength, the highest... -
Synthesis and Characterization of Cp*<sub>3</sub>Ru<sub>3</sub>B<sub>3</sub>H...
Synthesis and Characterization of Cp3Ru3B3H8, Cp = η5-C5Me5, Exhibiting a Capped Nido Geometry. Cluster Geometry Driven by Hydrogen Bridging -
Parameters used in the study.
1aa sequence: YAAAQWDFGNTMCQ.2aa sequence: QNQQEKNEQELLELDKWASLWNWFNITNWYIK.3aa sequence: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF.4aa sequence: GIKQLQARILAVERYLKDQQLLG. -
Subjects’ characteristics.
Δ changes over 12 weeks. BMI, Body Mass Index; FM, fat mass; FFM, fat free mass; PAL, physical activity level. These data concern the as analysed population and not the as... -
Patient Characteristics.
Abbreviations: AML, acute myeloid leukemia; sAML, secondary AML; ALL, acute lymphoblastic leukemia; PMF, primary myelofibrosis; CLL: chronic lymphoblastic leukemia; SAA, severe... -
Structural Effects Affecting the Thermal Electrocyclic Ring Closure of Vinyla...
The thermal electrocyclic ring closure of (2E,7E)-3,4,7-trialkylnona-2,4,5,7-tetraenes (divinyl-4,5-allenes) is regioselective, occurring at the most sterically congested... -
Bacterial strains and plasmids.
aProvided by Jon Beckwith.bIn the experiment with HU (Figure 2, Table 2) the LJ52 strain was used. It is referred to as MG1655 for simplicity.cObtained from The Coli Genetic... -
Principal Component Analysis
Copyright information:Taken from "Combined histomorphometric and gene-expression profiling applied to toxicology"Genome Biology 2003;4(5):R32-R32.Published online 30 Apr... -
Data collection and refinement statistics.
1Statistics for data from the highest-resolution shell are shown in parentheses. 2 R sym =(ΣΣ|Ihkl−〈I〉|)/(ΣIhkl), where the average intensity <I> is taken... -
Baseline characteristics.
*School-level deprivation uses the decile assigned to each school by the New Zealand Ministry of Education for funding purposes. It reflects the proportion of students who live... -
Using highly uniform and smooth selenium colloids as low-loss magnetodielectr...
We systematically analyzed the magnetodielectric resonances of Se colloids for the first time in an attempt to utilize them as building blocks for all-dielectric optical... -
Baseline characteristics of the study population.
Values are expressed as medians (range or percentage). * Hypertension: Yes = systolic blood pressure ≥140 mmHg, diastolic blood pressure ≥90 mmHg, or treated with...
