-
Characteristics of patients included in the study.
CRC, colorectal cancer; NA, not applied. 1Qualitative variables were compared by the Fisher's exact test; continuous variables were compared by the Mann-Whitney U's... -
Room-Temperature Desulfurization of Dibenzothiophene Mediated by [(<i>i</i>-P...
Room-Temperature Desulfurization of Dibenzothiophene Mediated by [(i-Pr2PCH2)2NiH]2 -
Characteristics of study subjects.
JA-1, first-generation Japanese-Americans; JA-2, second- or later-generation Japanese-Americans; BMI, body mass index; BP, blood pressure; 2-h, two-hour post-load; HOMA-IR,... -
Primers used in this study.
a Liu et al., 2011 [19]. b Ji et al., 2007 [20]. c Wei et al., 2010 [21]. d Noteborn et al., 2013 [22]. *Positions correspond to: IBDV (JQ684022), IBV (KJ425500), AEV... -
MOESM1 of Expression profiling of the ubiquitin conjugating enzyme UbcM2 in m...
Additional file 1: Figure S1. UbcM2 is ubiquitously expressed in neurons of mouse brain. Representative photomicrographs from a 7 µm paraffin-embedded sagittal brain section... -
Characteristics of the study population.
SD = standard deviation; BMI = body mass index; BFP = Body fat percentage measured with bioelectrical impedance [24]; WHR = waist-hip ratio; HGS = handgrip strength, the highest... -
Synthesis and Characterization of Cp*<sub>3</sub>Ru<sub>3</sub>B<sub>3</sub>H...
Synthesis and Characterization of Cp3Ru3B3H8, Cp = η5-C5Me5, Exhibiting a Capped Nido Geometry. Cluster Geometry Driven by Hydrogen Bridging -
Parameters used in the study.
1aa sequence: YAAAQWDFGNTMCQ.2aa sequence: QNQQEKNEQELLELDKWASLWNWFNITNWYIK.3aa sequence: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF.4aa sequence: GIKQLQARILAVERYLKDQQLLG. -
Subjects’ characteristics.
Δ changes over 12 weeks. BMI, Body Mass Index; FM, fat mass; FFM, fat free mass; PAL, physical activity level. These data concern the as analysed population and not the as... -
Patient Characteristics.
Abbreviations: AML, acute myeloid leukemia; sAML, secondary AML; ALL, acute lymphoblastic leukemia; PMF, primary myelofibrosis; CLL: chronic lymphoblastic leukemia; SAA, severe... -
Bacterial strains and plasmids.
aProvided by Jon Beckwith.bIn the experiment with HU (Figure 2, Table 2) the LJ52 strain was used. It is referred to as MG1655 for simplicity.cObtained from The Coli Genetic... -
Principal Component Analysis
Copyright information:Taken from "Combined histomorphometric and gene-expression profiling applied to toxicology"Genome Biology 2003;4(5):R32-R32.Published online 30 Apr... -
Data collection and refinement statistics.
1Statistics for data from the highest-resolution shell are shown in parentheses. 2 R sym =(ΣΣ|Ihkl−〈I〉|)/(ΣIhkl), where the average intensity <I> is taken... -
Baseline characteristics.
*School-level deprivation uses the decile assigned to each school by the New Zealand Ministry of Education for funding purposes. It reflects the proportion of students who live... -
Baseline characteristics of the study population.
Values are expressed as medians (range or percentage). * Hypertension: Yes = systolic blood pressure ≥140 mmHg, diastolic blood pressure ≥90 mmHg, or treated with... -
Plasmids used in this study.
aLike YCpHA-BUD8 [20] except in a YEplac111 [53] background.bLike YEpGFP*-BUD8 [20] except with two in-frame copies of the GFP coding sequence and in a YCplac33 [53] background. -
Experimental groups.
Adult male and female mice used in this study were; Mc1re, recessive yellow mice, which are null mutants with a non-functional MC1R resulting in a yellow coat colour and their... -
Study design.
Study type refers to the type of model and the inclusion of risk heterogeneity in the population modelled. Setting/MoT refers to the geographical setting and the mode of... -
Additional file 20:Â Dataset S12. of No evidence for a bovine mastitis Escher...
Pathotype-enriched (with Fisherâs exact test p-values), group soft core, and unspecific categorisation of the fec, paa, and pga gene regions in the ten phylogroup B1...
