-
Inclusion criteria.
a. IFs added as supplementary information after completion of the project. They refer to the years 2013–2014 (except for the Journal of the American Medical Association: 2015).... -
Demographic data
**P<0.01; SD, standard deviation; Max/Min, maximal/minimal.The number of participants did not differ between genders (Chi-square P>0.05). The dancer and pianist groups... -
Characteristics of respondents.
1Age at the time of the first interview appointment.†deceased within data collection period.*withdrew from the study.CVA: Cerebrovascular accident.COPD: Chronic obstructive... -
Field Data
Life history data for seed from five source populations (AFT - Afton State Park, Afton, MN; GCD - Grey Cloud Dunes Scientific and Natural Area, Cottage Grove, MN; CRA - Conard... -
Characteristics of the participants.
Abbreviations: SD, standard deviation; BMI, body mass index; WC, waist circumference; WHtR, waist-to-height ratio; HDL-c, high-density lipoprotein cholesterol; LDL-c,... -
Baseline characteristics of participants.
Data are presented as mean±SD, median (interquartile range) or percent. Chi-square test for categorical variables, the unpaired t test or Mann-Whitney U test for continuous... -
Summary of patient characteristics.
Gender was missing in 19 cases.*Last five years of study only.†In those for whom country of birth is recorded, the five largest non-UK countries were Pakistan (35.8%), India... -
Characteristics of Study Population.
Continuous variables are presented as median and range. 1: CD: Crohn’s disease, UC: ulcerative colitis, IBS-D: diarrhea predominant IBS, IBS-C: constipation predominant IBS,... -
Model parameters.
aSpecified with reference to Cook [30] and Waage et al. [36] using distributions defined in Biosecurity Australia [31]; b Derived from Sapoukhina et al. [37]; c ABS [6], Note... -
Demographic characteristics of subjects.
Mean (SD) values of demographic characteristics of hemiplegic patients and healthy subjects. For clinical examination, median values are presented (mean and standard deviation... -
Characteristics of the study participants.
The continuous variables are presented as mean (SD) and p-value (t-test). The discrete variables are presented as frequency (%) and p-value (χ2 -test). In Model 1A, HTN is... -
Characteristics of study subjects.
JA-1, first-generation Japanese-Americans; JA-2, second- or later-generation Japanese-Americans; BMI, body mass index; BP, blood pressure; 2-h, two-hour post-load; HOMA-IR,... -
Primers used in this study.
a Liu et al., 2011 [19]. b Ji et al., 2007 [20]. c Wei et al., 2010 [21]. d Noteborn et al., 2013 [22]. *Positions correspond to: IBDV (JQ684022), IBV (KJ425500), AEV... -
Characteristics of the study population.
SD = standard deviation; BMI = body mass index; BFP = Body fat percentage measured with bioelectrical impedance [24]; WHR = waist-hip ratio; HGS = handgrip strength, the highest... -
Description of study sample.
* All variables except ApoE genotype: Number of missing values: 0–22; ApoE genotype: Number of missing values: 117. χ2 test or Linear Trend test for group... -
Characteristics of the study subjects.
All values except number of subjects, gender and smoking status are expressed as median values with minimum and maximum range in parentheses. Ex-smoker: stopped smoking for at... -
Survey data
This cross-sectional study was done in ART clinics in Jinja district among 206 HIV positive children under five years who had been on ART for at least three months. Data were... -
Parameters used in the study.
1aa sequence: YAAAQWDFGNTMCQ.2aa sequence: QNQQEKNEQELLELDKWASLWNWFNITNWYIK.3aa sequence: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF.4aa sequence: GIKQLQARILAVERYLKDQQLLG. -
Population characteristics.
Data are expressed as mean ± standard error or as percentages. Abbreviations: CRP: C-reactive protein, DAS28: disease activity score using 28 joint counts, DMARDs:...