48 items found

Tags: 69999 Biological Sciences not elsewhere classified Cell Biology public health and epidemiology

Filter Results
  • dataset

    Inclusion criteria.

    a. IFs added as supplementary information after completion of the project. They refer to the years 2013–2014 (except for the Journal of the American Medical Association: 2015)....
  • dataset

    Demographic data

    **P<0.01; SD, standard deviation; Max/Min, maximal/minimal.The number of participants did not differ between genders (Chi-square P>0.05). The dancer and pianist groups...
  • dataset

    Characteristics of the participants.

    Abbreviations: SD, standard deviation; BMI, body mass index; WC, waist circumference; WHtR, waist-to-height ratio; HDL-c, high-density lipoprotein cholesterol; LDL-c,...
  • dataset

    Baseline characteristics of participants.

    Data are presented as mean±SD, median (interquartile range) or percent. Chi-square test for categorical variables, the unpaired t test or Mann-Whitney U test for continuous...
  • dataset

    Summary of patient characteristics.

    Gender was missing in 19 cases.*Last five years of study only.†In those for whom country of birth is recorded, the five largest non-UK countries were Pakistan (35.8%), India...
  • dataset

    Characteristics of Study Population.

    Continuous variables are presented as median and range. 1: CD: Crohn’s disease, UC: ulcerative colitis, IBS-D: diarrhea predominant IBS, IBS-C: constipation predominant IBS,...
  • dataset

    Model parameters.

    aSpecified with reference to Cook [30] and Waage et al. [36] using distributions defined in Biosecurity Australia [31]; b Derived from Sapoukhina et al. [37]; c ABS [6], Note...
  • dataset

    Demographic characteristics of subjects.

    Mean (SD) values of demographic characteristics of hemiplegic patients and healthy subjects. For clinical examination, median values are presented (mean and standard deviation...
  • dataset

    Baseline demographics.

    Baseline Demographics.
  • dataset

    Characteristics of the study participants.

    The continuous variables are presented as mean (SD) and p-value (t-test). The discrete variables are presented as frequency (%) and p-value (χ2 -test). In Model 1A, HTN is...
  • dataset

    Characteristics of study subjects.

    JA-1, first-generation Japanese-Americans; JA-2, second- or later-generation Japanese-Americans; BMI, body mass index; BP, blood pressure; 2-h, two-hour post-load; HOMA-IR,...
  • dataset

    Primers used in this study.

    a Liu et al., 2011 [19]. b Ji et al., 2007 [20]. c Wei et al., 2010 [21]. d Noteborn et al., 2013 [22]. *Positions correspond to: IBDV (JQ684022), IBV (KJ425500), AEV...
  • dataset

    Characteristics of the study population.

    SD = standard deviation; BMI = body mass index; BFP = Body fat percentage measured with bioelectrical impedance [24]; WHR = waist-hip ratio; HGS = handgrip strength, the highest...
  • dataset

    Characteristics of the study subjects.

    All values except number of subjects, gender and smoking status are expressed as median values with minimum and maximum range in parentheses. Ex-smoker: stopped smoking for at...
  • dataset

    Parameters used in the study.

    1aa sequence: YAAAQWDFGNTMCQ.2aa sequence: QNQQEKNEQELLELDKWASLWNWFNITNWYIK.3aa sequence: YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF.4aa sequence: GIKQLQARILAVERYLKDQQLLG.
  • dataset

    Population characteristics.

    Data are expressed as mean ± standard error or as percentages. Abbreviations: CRP: C-reactive protein, DAS28: disease activity score using 28 joint counts, DMARDs:...
  • dataset

    Demographic characteristics of the study population.

    Continuous variables are reported as mean ± standard deviation, (5th and 95th percentile); categorical variables are presented as counts and frequencies. Abbreviations: ASA =...
  • dataset

    Description of variables.

    AHS = Annual Health Survey; SA = Statistical Abstract; HD, IMD = Hydromet Division, India Meteorological Department; DES, MoA, GoI = The Directorate of Economics & Statistics...
  • dataset

    Patient Characteristics.

    Abbreviations: AML, acute myeloid leukemia; sAML, secondary AML; ALL, acute lymphoblastic leukemia; PMF, primary myelofibrosis; CLL: chronic lymphoblastic leukemia; SAA, severe...
  • dataset

    Descriptive statistics.

    Table 1.  Descriptive statistics. (Notes: the R&D rec. and the R&D high variables are dummy variables equal to 1 if the associated expert's cost estimate...